RecombinantFlt-3L,Human

Product Overview

• Article Name: RecombinantFlt-3L,Human
• Biozol Catalog Number: BWT-BK0203
• Supplier Catalog Number: BK0203
• Alternative Catalog Number: BWT-BK0203-10UG,BWT-BK0203-1MG,BWT-BK0203-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth fa

Product Properties

• Molecular Weight: Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.