RecombinantGCP-2/CXCL6,Human

Product Overview

• Article Name: RecombinantGCP-2/CXCL6,Human
• Biozol Catalog Number: BWT-BK0205
• Supplier Catalog Number: BK0205
• Alternative Catalog Number: BWT-BK0205-25UG,BWT-BK0205-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human

Product Properties

• Molecular Weight: 9 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.