RecombinantG-CSF,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantG-CSF,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0206
• Supplier Catalog Number: BK0206
• Alternative Catalog Number: BWT-BK0206-10UG,BWT-BK0206-1MG,BWT-BK0206-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Human Granulocyte Colony Stimulating Factor (G-CSF) contains internal disulfide bonds. Among the family of colony-stimulating factors, Granulocyte Colony Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation to granulocytes an

Product Properties

• Molecular Weight: 18.7kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHS GLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF LEVSYRVLRHLAQP
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.