RecombinantGDNF,Human

Product Overview

• Article Name: RecombinantGDNF,Human
• Biozol Catalog Number: BWT-BK0208
• Supplier Catalog Number: BK0208
• Alternative Catalog Number: BWT-BK0208-10UG,BWT-BK0208-1MG,BWT-BK0208-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Glial cell line-derived neurotrophic factor (G-DNF) is a neurotrophic factors belong to TGF-beta super family necessary for neuron survival and phenotypic maintenance in central and peripheral nervous systems [1]. G-DNF has the potent to support the diff

Product Properties

• Molecular Weight: 30.4 kDa (homo-dimer), observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDL SFLDDNLVYHILRKHSAKRCGCI
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.