RecombinantGH,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantGH,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0210
• Supplier Catalog Number: BK0210
• Alternative Catalog Number: BWT-BK0210-10UG,BWT-BK0210-1MG,BWT-BK0210-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Growth hormone (GH), also known as somatotropin, is a member of a family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. It is synthesized primarily by somatotropes in the anterior pituitary and is stored in

Product Properties

• Molecular Weight: 20-24 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: FPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISL LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.