RecombinantGM-CSF,Mouse

Product Overview

• Article Name: RecombinantGM-CSF,Mouse
• Biozol Catalog Number: BWT-BK0212
• Supplier Catalog Number: BK0212
• Alternative Catalog Number: BWT-BK0212-10UG,BWT-BK0212-1MG,BWT-BK0212-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including a

Product Properties

• Molecular Weight: 15~19 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.