RecombinantGM-CSF,Rat

Product Overview

• Article Name: RecombinantGM-CSF,Rat
• Biozol Catalog Number: BWT-BK0213
• Supplier Catalog Number: BK0213
• Alternative Catalog Number: BWT-BK0213-10UG,BWT-BK0213-1MG,BWT-BK0213-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is pr

Product Properties

• Molecular Weight: 16-26 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMI ASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.