RecombinantGRO/MGSA/CXCL1,Human

Product Overview

• Article Name: RecombinantGRO/MGSA/CXCL1,Human
• Biozol Catalog Number: BWT-BK0215
• Supplier Catalog Number: BK0215
• Alternative Catalog Number: BWT-BK0215-1MG,BWT-BK0215-25UG,BWT-BK0215-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 recep

Product Properties

• Molecular Weight: ~7.8 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.