RecombinantGRO-alpha/KC/CXCL1,Mouse(CHO-expressed)

Product Overview

• Article Name: RecombinantGRO-alpha/KC/CXCL1,Mouse(CHO-expressed)
• Biozol Catalog Number: BWT-BK0216
• Supplier Catalog Number: BK0216
• Alternative Catalog Number: BWT-BK0216-1MG,BWT-BK0216-25UG,BWT-BK0216-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemok

Product Properties

• Molecular Weight: 5-7 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.