RecombinantGRO-gamma/CXCL3,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantGRO-gamma/CXCL3,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0217
• Supplier Catalog Number: BK0217
• Alternative Catalog Number: BWT-BK0217-10UG,BWT-BK0217-1MG,BWT-BK0217-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3), GRO protein gamma (GROg) and macrophage inflammatory protein-2-beta (MIP2b). CXCL3 controls migration and adhes

Product Properties

• Molecular Weight: 9 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQ KIIEKILNKGSTN
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.