RecombinantHB-EGF,Human

Product Overview

• Article Name: RecombinantHB-EGF,Human
• Biozol Catalog Number: BWT-BK0218
• Supplier Catalog Number: BK0218
• Alternative Catalog Number: BWT-BK0218-1MG,BWT-BK0218-25UG,BWT-BK0218-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to sti

Product Properties

• Molecular Weight: 12-14 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.