RecombinantHCC-4/CCL16,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantHCC-4/CCL16,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0219
• Supplier Catalog Number: BK0219
• Alternative Catalog Number: BWT-BK0219-10UG,BWT-BK0219-1MG,BWT-BK0219-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Human HCC4, also named NCC4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal th

Product Properties

• Molecular Weight: 12 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.