RecombinantI-309/CCL1,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantI-309/CCL1,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0221
• Supplier Catalog Number: BK0221
• Alternative Catalog Number: BWT-BK0221-10UG,BWT-BK0221-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only app

Product Properties

• Molecular Weight: 15 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQR HRKMLRHCPSKRK
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.