RecombinantIFN-gamma,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantIFN-gamma,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0223
• Supplier Catalog Number: BK0223
• Alternative Catalog Number: BWT-BK0223-10UG,BWT-BK0223-1MG,BWT-BK0223-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Human Interferon gamma (hIFN-gamma) is amacrophage-activating factor and the lone member of Interferon type II. The active form of IFN-gamma is an antiparallel dimer that interacts with the receptor IFN-gammaR1 and sets off IFN-gamma/JAK/STAT pathway. IFN-gamma signaling do

Product Properties

• Molecular Weight: 15-25 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVK FFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.