RecombinantIFN-gamma,Rat(CHO-expressed)

Catalog Number: BWT-BK0224
Article Name: RecombinantIFN-gamma,Rat(CHO-expressed)
Biozol Catalog Number: BWT-BK0224
Supplier Catalog Number: BK0224
Alternative Catalog Number: BWT-BK0224-10UG,BWT-BK0224-1MG,BWT-BK0224-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interferon-gamma (IFN-gamma), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-gamma is an antiparallel dimer that interacts with the receptor IFN-gammaR1 and sets o
Molecular Weight: 15-25 kDa, observed by non-reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITN FFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.