RecombinantIL-11,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantIL-11,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0228
• Supplier Catalog Number: BK0228
• Alternative Catalog Number: BWT-BK0228-25UG,BWT-BK0228-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1alpha-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple

Product Properties

• Molecular Weight: ~23 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADL LSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGL HLTLDWAVRGLLLLKTRL
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.