RecombinantIL-13,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantIL-13,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0232
• Supplier Catalog Number: BK0232
• Alternative Catalog Number: BWT-BK0232-10UG,BWT-BK0232-1MG,BWT-BK0232-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13

Product Properties

• Molecular Weight: 25-45 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.