RecombinantIL-1alpha,Rat

Product Overview

• Article Name: RecombinantIL-1alpha,Rat
• Biozol Catalog Number: BWT-BK0237
• Supplier Catalog Number: BK0237
• Alternative Catalog Number: BWT-BK0237-10UG,BWT-BK0237-1MG,BWT-BK0237-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-1 alpha (IL-1alpha), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological propertie

Product Properties

• Molecular Weight: 17~22 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLF VSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.