RecombinantIL-1beta,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantIL-1beta,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0238
• Supplier Catalog Number: BK0238
• Alternative Catalog Number: BWT-BK0238-10UG,BWT-BK0238-1MG,BWT-BK0238-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin 1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical b

Product Properties

• Molecular Weight: 17kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.