RecombinantIL-1beta,Mouse(CHO-expressed)

Catalog Number: BWT-BK0239
Article Name: RecombinantIL-1beta,Mouse(CHO-expressed)
Biozol Catalog Number: BWT-BK0239
Supplier Catalog Number: BK0239
Alternative Catalog Number: BWT-BK0239-10UG,BWT-BK0239-1MG,BWT-BK0239-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interleukin-1 (IL-1) is a family of cytokines that play a central role in the regulation of immune and inflammatory responses to infections or sterile insults. IL-1alpha and IL-1beta are the first two members discovered in this family, which are the products of
Molecular Weight: 17.4 kDa, observed by non-reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.