RecombinantIL-3,His,Rat

Product Overview

• Article Name: RecombinantIL-3,His,Rat
• Biozol Catalog Number: BWT-BK0242
• Supplier Catalog Number: BK0242
• Alternative Catalog Number: BWT-BK0242-10UG,BWT-BK0242-1MG,BWT-BK0242-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe alpha-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alp

Product Properties

• Molecular Weight: 22-34 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.