RecombinantIL-4,Porcine

Catalog Number: BWT-BK0247
Article Name: RecombinantIL-4,Porcine
Biozol Catalog Number: BWT-BK0247
Supplier Catalog Number: BK0247
Alternative Catalog Number: BWT-BK0247-10UG,BWT-BK0247-1MG,BWT-BK0247-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells.
Molecular Weight: 15kDa, observed by reducing SDS-PAGE
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.