RecombinantIL-5,Mouse(CHO-expressed)

Product Overview

• Article Name: RecombinantIL-5,Mouse(CHO-expressed)
• Biozol Catalog Number: BWT-BK0250
• Supplier Catalog Number: BK0250
• Alternative Catalog Number: BWT-BK0250-10UG,BWT-BK0250-1MG,BWT-BK0250-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilizati

Product Properties

• Molecular Weight: 25-40 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQ KEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.