RecombinantIL-5,Rat(CHO-expressed)

Product Overview

• Article Name: RecombinantIL-5,Rat(CHO-expressed)
• Biozol Catalog Number: BWT-BK0251
• Supplier Catalog Number: BK0251
• Alternative Catalog Number: BWT-BK0251-10UG,BWT-BK0251-1MG,BWT-BK0251-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, mediates the activities of eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and

Product Properties

• Molecular Weight: 13~21 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQ KEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.