RecombinantIL-6,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantIL-6,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0253
• Supplier Catalog Number: BK0253
• Alternative Catalog Number: BWT-BK0253-10UG,BWT-BK0253-1MG,BWT-BK0253-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 bin

Product Properties

• Molecular Weight: 21-23 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.