RecombinantIL-7,His,Rat

Catalog Number: BWT-BK0257
Article Name: RecombinantIL-7,His,Rat
Biozol Catalog Number: BWT-BK0257
Supplier Catalog Number: BK0257
Alternative Catalog Number: BWT-BK0257-10UG,BWT-BK0257-1MG,BWT-BK0257-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and sig
Molecular Weight: 20-28 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLR VSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSIHHHHHH
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.