RecombinantIL-8/CXCL8(8-79aa),Human(CHO-expressed)

Product Overview

• Article Name: RecombinantIL-8/CXCL8(8-79aa),Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0258
• Supplier Catalog Number: BK0258
• Alternative Catalog Number: BWT-BK0258-10UG,BWT-BK0258-1MG,BWT-BK0258-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to c

Product Properties

• Molecular Weight: ~9 kDa, observed by reducing SDS-PAGE
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.