RecombinantIL-9,Human

Product Overview

• Article Name: RecombinantIL-9,Human
• Biozol Catalog Number: BWT-BK0259
• Supplier Catalog Number: BK0259
• Alternative Catalog Number: BWT-BK0259-10UG,BWT-BK0259-1MG,BWT-BK0259-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a vari

Product Properties

• Molecular Weight: 25-40 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEV LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.