RecombinantLIX/CXCL5(88aa),Rat

Product Overview

• Article Name: RecombinantLIX/CXCL5(88aa),Rat
• Biozol Catalog Number: BWT-BK0263
• Supplier Catalog Number: BK0263
• Alternative Catalog Number: BWT-BK0263-10UG,BWT-BK0263-1MG,BWT-BK0263-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

LPSinduced CXC chemokine (LIX), also known as C-X-C motif chemokine 5(CXCL5), is a small cytokine belonging to the CXC chemokine family that is also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). It is produced following stimulati

Product Properties

• Molecular Weight: 9.6 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQK ILGSENKKTKRNALALVR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.