RecombinantMCP-3/MARC/CCL7,Mouse

Catalog Number: BWT-BK0265
Article Name: RecombinantMCP-3/MARC/CCL7,Mouse
Biozol Catalog Number: BWT-BK0265
Supplier Catalog Number: BK0265
Alternative Catalog Number: BWT-BK0265-10UG,BWT-BK0265-1MG,BWT-BK0265-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
Chemokine (C-C motif) ligand 7 (CCL7) is a small cytokine that was previously called monocyte-specific chemokine 3 (MCP-3). Due to CCL7 possessing two adjacent N-terminal cysteine residues in its mature form, it is classified within the subfamily of chem
Molecular Weight: 8~12 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 98% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEE AIAYLDMKTPTPKP
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.