RecombinantM-CSF,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantM-CSF,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0267
• Supplier Catalog Number: BK0267
• Alternative Catalog Number: BWT-BK0267-10UG,BWT-BK0267-1MG,BWT-BK0267-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Human Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CS

Product Properties

• Molecular Weight: 32-40 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQL QELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.