RecombinantM-CSF,Mouse

Product Overview

• Article Name: RecombinantM-CSF,Mouse
• Biozol Catalog Number: BWT-BK0268
• Supplier Catalog Number: BK0268
• Alternative Catalog Number: BWT-BK0268-10UG,BWT-BK0268-1MG,BWT-BK0268-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF i

Product Properties

• Molecular Weight: 35-44 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERL QELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.