RecombinantMIP-1alpha/CCL3,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantMIP-1alpha/CCL3,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0270
• Supplier Catalog Number: BK0270
• Alternative Catalog Number: BWT-BK0270-10UG,BWT-BK0270-1MG,BWT-BK0270-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

MIP-1 Alpha, also known as CCL3, G0S19-1 and SCYA3, is a small inducible monokine belonging to the intercrine beta (chemokine CC) family. It binds to CCR1, CCR4 and CCR5, and participates in the host response to invading pathogens by regulating the traff

Product Properties

• Molecular Weight: 8-10 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.