RecombinantMIP-1beta/CCL4,Human

Product Overview

• Article Name: RecombinantMIP-1beta/CCL4,Human
• Biozol Catalog Number: BWT-BK0271
• Supplier Catalog Number: BK0271
• Alternative Catalog Number: BWT-BK0271-1MG,BWT-BK0271-25UG,BWT-BK0271-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Macrophage inflammatory protein 1 beta (MIP-1beta), also known as Chemokine (C-C motif) ligand 4 (CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemo attractant for natural killer cells, monocytes and a variety of other immune cel

Product Properties

• Molecular Weight: 10-19 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.