RecombinantMIP-3alpha/CCL20,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantMIP-3alpha/CCL20,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0272
• Supplier Catalog Number: BK0272
• Alternative Catalog Number: BWT-BK0272-1MG,BWT-BK0272-25UG,BWT-BK0272-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Chemokine (C-C motif) ligand 20 (CCL20) also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and w

Product Properties

• Molecular Weight: 8 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIV RLLSKKVKNM
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.