RecombinantMPIF-1/CCL23,Human

Product Overview

• Article Name: RecombinantMPIF-1/CCL23,Human
• Biozol Catalog Number: BWT-BK0274
• Supplier Catalog Number: BK0274
• Alternative Catalog Number: BWT-BK0274-10UG,BWT-BK0274-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Myeloid progenitor inhibitory factor 1 (MPIF-1), also known as Chemokine (C-C motif) ligand 23 (CCL23) is a small cytokine belonging to the CC chemokine family.MPIF-1is predominantly expressed in lung and liver tissue, but is also found in bone marrow an

Product Properties

• Molecular Weight: 12 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKP GVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.