RecombinantNAP-2/CXCL7,Human(CHO-expressed)

Product Overview

• Article Name: RecombinantNAP-2/CXCL7,Human(CHO-expressed)
• Biozol Catalog Number: BWT-BK0275
• Supplier Catalog Number: BK0275
• Alternative Catalog Number: BWT-BK0275-10UG,BWT-BK0275-1MG,BWT-BK0275-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Chemokine (C-X-C motif) ligand(CXCL7) is a small cytokine belonging to the CXC chemokine family. It is an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein (PPBP). CXCL7can signal through the CXCR1 and CXCR2 receptors. It is a protein that is

Product Properties

• Molecular Weight: 9 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.