RecombinantNoggin,Mouse(CHO-expressed)

Product Overview

• Article Name: RecombinantNoggin,Mouse(CHO-expressed)
• Biozol Catalog Number: BWT-BK0278
• Supplier Catalog Number: BK0278
• Alternative Catalog Number: BWT-BK0278-25UG,BWT-BK0278-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Noggin, also known as NOG, is a homodimeric glycoprotein that binds to and modulates the activity of TGF-beta family ligands. It is expressed in condensing cartilage and immature chondrocytes. Noggin antagonizes bone morphogenetic protein (BMP) activitie

Product Properties

• Molecular Weight: 29-31 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAE DLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCF SKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.