RecombinantOTOR,Human

Catalog Number: BWT-BK0280
Article Name: RecombinantOTOR,Human
Biozol Catalog Number: BWT-BK0280
Supplier Catalog Number: BK0280
Alternative Catalog Number: BWT-BK0280-10UG,BWT-BK0280-1MG,BWT-BK0280-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member of the melanoma-inhibiting activity gene family. Members of this family which also includes MIA, MIA2, and TANGO share a SRC homology-3 (SH3)-like domain. OTOR appears to be involv
Molecular Weight: 14-15 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENG AGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.