RecombinantPDGF-DD,Human

Product Overview

• Article Name: RecombinantPDGF-DD,Human
• Biozol Catalog Number: BWT-BK0281
• Supplier Catalog Number: BK0281
• Alternative Catalog Number: BWT-BK0281-10UG,BWT-BK0281-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind

Product Properties

• Molecular Weight: 19-21 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.