RecombinantSDF-1beta/CXCL12,Mouse

Product Overview

• Article Name: RecombinantSDF-1beta/CXCL12,Mouse
• Biozol Catalog Number: BWT-BK0283
• Supplier Catalog Number: BK0283
• Alternative Catalog Number: BWT-BK0283-10UG,BWT-BK0283-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

SDF-1 alpha and SDF-1 beta, members of the chemokine alpha subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 alpha and SDF-1 beta cDNAs encode precursor proteins

Product Properties

• Molecular Weight: 8.5 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQE YLEKALNKRLKM
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.