RecombinantShh,Mouse(CHO-expressed)

Product Overview

• Article Name: RecombinantShh,Mouse(CHO-expressed)
• Biozol Catalog Number: BWT-BK0284
• Supplier Catalog Number: BK0284
• Alternative Catalog Number: BWT-BK0284-10UG,BWT-BK0284-1MG,BWT-BK0284-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Members of the Hedgehog (Hh) family are highly conserved proteins which are widely represented throughout the animal kingdom. The three known mammalian Hh proteins, Sonic (Shh), Desert (Dhh) and Indian (Ihh) are structurally related and share a high degr

Product Properties

• Molecular Weight: 20 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK DKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHC SVKAENSVAAKSGG
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.