RecombinantTGF-alpha,Human

Product Overview

• Article Name: RecombinantTGF-alpha,Human
• Biozol Catalog Number: BWT-BK0285
• Supplier Catalog Number: BK0285
• Alternative Catalog Number: BWT-BK0285-25UG,BWT-BK0285-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Protransforming Growth Factor-alpha (TGF-alpha), also known as sarcoma growth factor, TGF-type I and ETGF, is a member of the EGF family of cytokines. It is expressed in monocytes, brain cells, keratinocytes and various tumor cells. ProTGF-alpha signals

Product Properties

• Molecular Weight: 8-10 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.