RecombinantThymusChemokine-1/CXCL7,Rat

Product Overview

• Article Name: RecombinantThymusChemokine-1/CXCL7,Rat
• Biozol Catalog Number: BWT-BK0286
• Supplier Catalog Number: BK0286
• Alternative Catalog Number: BWT-BK0286-1MG,BWT-BK0286-25UG,BWT-BK0286-5UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Thymus Chemokine-1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7) , is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine-1 has been shown to bind CXCR-2 and be

Product Properties

• Molecular Weight: 9.8 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 97% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.