RecombinantTNFRI,Human

Catalog Number: BWT-BK0287
Article Name: RecombinantTNFRI,Human
Biozol Catalog Number: BWT-BK0287
Supplier Catalog Number: BK0287
Alternative Catalog Number: BWT-BK0287-10UG,BWT-BK0287-50UG
Manufacturer: Bioworld Technology
Category: Biochemikalien
TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-alpha or TNF-beta to TNF-R1 initiates a signal transduction
Molecular Weight: 28~35 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE N
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.