RecombinantTPO,His,Rat

Product Overview

• Article Name: RecombinantTPO,His,Rat
• Biozol Catalog Number: BWT-BK0288
• Supplier Catalog Number: BK0288
• Alternative Catalog Number: BWT-BK0288-10UG,BWT-BK0288-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Thrombopoietin (TPO), also known as c-Mpl ligand, MGDF and THOP, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through c-Mpl receptor. It stimulates the p

Product Properties

• Molecular Weight: 22 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 98% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTA VPSRTSQLLTLNKFHHHHHH
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.