RecombinantTWEAK,Human

Product Overview

• Article Name: RecombinantTWEAK,Human
• Biozol Catalog Number: BWT-BK0290
• Supplier Catalog Number: BK0290
• Alternative Catalog Number: BWT-BK0290-10UG,BWT-BK0290-1MG,BWT-BK0290-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and per

Product Properties

• Molecular Weight: 20-22 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLK LDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.