RecombinantVEGF165,Rat(CHO-expressed)

Product Overview

• Article Name: RecombinantVEGF165,Rat(CHO-expressed)
• Biozol Catalog Number: BWT-BK0293
• Supplier Catalog Number: BK0293
• Alternative Catalog Number: BWT-BK0293-10UG,BWT-BK0293-1MG,BWT-BK0293-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothel

Product Properties

• Molecular Weight: 35-48 kDa, observed by non-reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIM RIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCD KPRR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.