RecombinantVEGF-D,Human

Product Overview

• Article Name: RecombinantVEGF-D,Human
• Biozol Catalog Number: BWT-BK0294
• Supplier Catalog Number: BK0294
• Alternative Catalog Number: BWT-BK0294-10UG,BWT-BK0294-1MG,BWT-BK0294-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Vascular Endothelial Growth Factor (VEGF)-D, also known as c-Fos-induced growth factor (FIGF), is a member of the PDGF/VEGF growth factor family. It is expressed highly in lung, heart and small intestine, and at lower levels in skeletal muscle, colon and

Product Properties

• Molecular Weight: 18-19 kDa, observed by reducing SDS-PAGE.
• Source: CHO
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.