RecombinantAmphiregulin,Human

Product Overview

• Article Name: RecombinantAmphiregulin,Human
• Biozol Catalog Number: BWT-BK0297
• Supplier Catalog Number: BK0297
• Alternative Catalog Number: BWT-BK0297-10UG,BWT-BK0297-50UG
• Manufacturer: Bioworld Technology
• Category: Biochemikalien

Product Description

Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-alpha, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-alpha receptor, it stimulates growth of keratino

Product Properties

• Molecular Weight: 15~20 kDa, observed by reducing SDS-PAGE.
• Source: HEK 293
• Purity: > 95% as analyzed by SDS-PAGE.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK
• Formula: Lyophilized after extensive dialysis against PBS.

Application Notes

• Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.